PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G14060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 276aa    MW: 30078.7 Da    PI: 7.9372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G14060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++lv +++++G ++W++ ++  g+ R++k+c++rw +yl
  ORUFI10G14060.1 14 RGAWSPEEDDRLVAYIRRHGHPNWRALPKQAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.36.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++l+v++++ lG++ W++Ia+ m+ gRt++++k+ w+++l
  ORUFI10G14060.1  67 RGNFTADEEDLIVRLHNSLGNR-WSAIAAQMP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.091961IPR017930Myb domain
SuperFamilySSF466893.19E-2911108IPR009057Homeodomain-like
SMARTSM007177.1E-131363IPR001005SANT/Myb domain
PfamPF002496.9E-161461IPR001005SANT/Myb domain
CDDcd001673.60E-101661No hitNo description
PROSITE profilePS5129424.60762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-2665116IPR009057Homeodomain-like
SMARTSM007172.6E-1466114IPR001005SANT/Myb domain
PfamPF002493.5E-1567112IPR001005SANT/Myb domain
CDDcd001673.12E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MGRAPCCEKE GLRRGAWSPE EDDRLVAYIR RHGHPNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TADEEDLIVR LHNSLGNRWS AIAAQMPGRT DNEIKNVWHT HLKKRLDDER  120
KLAAAAGGGG RRPHTRKQPK AAKSAAAVKR EATPSVSVDT SSGVTCSTVT ESSPSSADGD  180
HRRQQQQTQH AAVKEESFSS GGELPAAAAA PTAAADMDES FWSSTEVTGM MAGLGDMDEE  240
LAIAGTSSAA AARSDDMEFW LKMLLESGDM RDLAVL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1090110.0AK109011.1 Oryza sativa Japonica Group cDNA clone:002-153-H11, full insert sequence.
GenBankCT8347440.0CT834744.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA107G14, full insert sequence.
GenBankY113500.0Y11350.1 O.sativa mRNA for myb factor, 1084 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612956.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0R0E70.0A0A0E0R0E7_ORYRU; Uncharacterized protein
STRINGLOC_Os10g33810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-74myb domain protein 15